Lineage for d1bwla_ (1bwl A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384012Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 384013Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins)
  6. 384137Protein Old yellow enzyme (OYE) [51401] (2 species)
  7. 384144Species Yeast (Candida albicans) [TaxId:5476] [51403] (2 PDB entries)
  8. 384146Domain d1bwla_: 1bwl A: [28606]
    complexed with fmn; mutant

Details for d1bwla_

PDB Entry: 1bwl (more details), 2.7 Å

PDB Description: old yellow enzyme (oye1) double mutant h191n:n194h

SCOP Domain Sequences for d1bwla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwla_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Yeast (Candida albicans)}
sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlwvlgw
aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
iaagadgveinsahgyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
ekglplnkydrdtfyqmsahgyidyptyeealklgwdks

SCOP Domain Coordinates for d1bwla_:

Click to download the PDB-style file with coordinates for d1bwla_.
(The format of our PDB-style files is described here.)

Timeline for d1bwla_: