Lineage for d1ep1a_ (1ep1 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116158Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 116159Family c.1.4.1: FMN-linked oxidoreductases [51396] (10 proteins)
  6. 116172Protein Dihydroorotate dehydrogenase [51397] (3 species)
  7. 116181Species Lactococcus lactis, isozyme B [TaxId:1358] [51399] (3 PDB entries)
  8. 116183Domain d1ep1a_: 1ep1 A: [28598]
    Other proteins in same PDB: d1ep1b1, d1ep1b2

Details for d1ep1a_

PDB Entry: 1ep1 (more details), 2.2 Å

PDB Description: crystal structure of lactococcus lactis dihydroorotate dehydrogenase b

SCOP Domain Sequences for d1ep1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep1a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B}
ennrlsvklpgldlknpiipasgcfgfgeeyakyydlnklgsimvkattlhprfgnptpr
vaetasgmlnaiglqnpglevimteklpwlnenfpelpiianvagseeadyvavcakigd
aanvkaielniscpnvkhggqafgtdpevaaalvkackavskvplyvklspnvtdivpia
kaveaagadgltmintlmgvrfdlktrqpilanitgglsgpaikpvalklihqvaqdvdi
piigmggvanaqdvlemymagasavavgtanfadpfvcpkiidklpelmdqyrieslesl
iqevkegkk

SCOP Domain Coordinates for d1ep1a_:

Click to download the PDB-style file with coordinates for d1ep1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ep1a_: