SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ep3a_ (1ep3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080046Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2080103Species Lactococcus lactis, isozyme B [TaxId:1358] [51399] (3 PDB entries)
    PyrD subunit
  8. 2080104Domain d1ep3a_: 1ep3 A: [28597]
    Other proteins in same PDB: d1ep3b1, d1ep3b2
    complexed with fad, fes, fmn

Details for d1ep3a_

PDB Entry: 1ep3 (more details), 2.1 Å

PDB Description: crystal structure of lactococcus lactis dihydroorotate dehydrogenase b. data collected under cryogenic conditions.
PDB Compounds: (A:) dihydroorotate dehydrogenase b (pyrd subunit)

SCOPe Domain Sequences for d1ep3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]}
mtennrlsvklpgldlknpiipasgcfgfgeeyakyydlnklgsimvkattlhprfgnpt
prvaetasgmlnaiglqnpglevimteklpwlnenfpelpiianvagseeadyvavcaki
gdaanvkaielniscpnvkhggqafgtdpevaaalvkackavskvplyvklspnvtdivp
iakaveaagadgltmintlmgvrfdlktrqpilanitgglsgpaikpvalklihqvaqdv
dipiigmggvanaqdvlemymagasavavgtanfadpfvcpkiidklpelmdqyriesle
sliqevkegkk

SCOPe Domain Coordinates for d1ep3a_:

Click to download the PDB-style file with coordinates for d1ep3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ep3a_: