Lineage for d1ep3a_ (1ep3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080046Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2080103Species Lactococcus lactis, isozyme B [TaxId:1358] [51399] (3 PDB entries)
    PyrD subunit
  8. 2080104Domain d1ep3a_: 1ep3 A: [28597]
    Other proteins in same PDB: d1ep3b1, d1ep3b2
    complexed with fad, fes, fmn

Details for d1ep3a_

PDB Entry: 1ep3 (more details), 2.1 Å

PDB Description: crystal structure of lactococcus lactis dihydroorotate dehydrogenase b. data collected under cryogenic conditions.
PDB Compounds: (A:) dihydroorotate dehydrogenase b (pyrd subunit)

SCOPe Domain Sequences for d1ep3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]}
mtennrlsvklpgldlknpiipasgcfgfgeeyakyydlnklgsimvkattlhprfgnpt
prvaetasgmlnaiglqnpglevimteklpwlnenfpelpiianvagseeadyvavcaki
gdaanvkaielniscpnvkhggqafgtdpevaaalvkackavskvplyvklspnvtdivp
iakaveaagadgltmintlmgvrfdlktrqpilanitgglsgpaikpvalklihqvaqdv
dipiigmggvanaqdvlemymagasavavgtanfadpfvcpkiidklpelmdqyriesle
sliqevkegkk

SCOPe Domain Coordinates for d1ep3a_:

Click to download the PDB-style file with coordinates for d1ep3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ep3a_: