Lineage for d1dorb_ (1dor B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681629Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 681630Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 681670Protein Dihydroorotate dehydrogenase [51397] (7 species)
  7. 681685Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (11 PDB entries)
  8. 681697Domain d1dorb_: 1dor B: [28596]
    complexed with fmn

Details for d1dorb_

PDB Entry: 1dor (more details), 2 Å

PDB Description: dihydroorotate dehydrogenase a from lactococcus lactis
PDB Compounds: (B:) dihydroorotate dehydrogenase a

SCOP Domain Sequences for d1dorb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dorb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOP Domain Coordinates for d1dorb_:

Click to download the PDB-style file with coordinates for d1dorb_.
(The format of our PDB-style files is described here.)

Timeline for d1dorb_: