Lineage for d2dorb_ (2dor B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1816697Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1816698Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1816743Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 1816780Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (9 PDB entries)
  8. 1816790Domain d2dorb_: 2dor B: [28594]
    complexed with fmn, oro

Details for d2dorb_

PDB Entry: 2dor (more details), 2 Å

PDB Description: dihydroorotate dehydrogenase a from lactococcus lactis complexed with orotate
PDB Compounds: (B:) dihydroorotate dehydrogenase a

SCOPe Domain Sequences for d2dorb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dorb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOPe Domain Coordinates for d2dorb_:

Click to download the PDB-style file with coordinates for d2dorb_.
(The format of our PDB-style files is described here.)

Timeline for d2dorb_: