Lineage for d2dorb_ (2dor B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (6 proteins) Protein Dihydroorotate dehydrogenase [51397] (3 species) 
Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (2 PDB entries) 
Domain d2dorb_: 2dor B: [28594]
Details for d2dorb_
PDB Entry: 2dor (more details), 2 Å
PDB Description: dihydroorotate dehydrogenase a from lactococcus lactis complexed with orotate
SCOP Domain Sequences for d2dorb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dorb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl
SCOP Domain Coordinates for d2dorb_:
Click to download the PDB-style file with coordinates for d2dorb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dorb_:
- d2dorb_ appears in SCOP 1.57
- d2dorb_ appears in the current release, SCOPe 2.08
View in 3D
