Lineage for d2tpsa_ (2tps A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18546Superfamily c.1.3: Thiamin phosphate synthase [51391] (1 family) (S)
  5. 18547Family c.1.3.1: Thiamin phosphate synthase [51392] (1 protein)
  6. 18548Protein Thiamin phosphate synthase [51393] (1 species)
  7. 18549Species Bacillus subtilis [TaxId:1423] [51394] (1 PDB entry)
  8. 18550Domain d2tpsa_: 2tps A: [28591]

Details for d2tpsa_

PDB Entry: 2tps (more details), 1.25 Å

PDB Description: thiamin phosphate synthase
PDB Compounds: (A:)

SCOP Domain Sequences for d2tpsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis}
hgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltge
arikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgv
sahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggi
tidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr

SCOP Domain Coordinates for d2tpsa_:

Click to download the PDB-style file with coordinates for d2tpsa_.
(The format of our PDB-style files is described here.)

Timeline for d2tpsa_: