Lineage for d2tsya_ (2tsy A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) 
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) Protein Trp synthase alpha-subunit [51388] (2 species) Species Salmonella typhimurium [TaxId:90371] [51389] (21 PDB entries) 
Domain d2tsya_: 2tsy A: [28583]
Other proteins in same PDB: d2tsyb_
Details for d2tsya_
PDB Entry: 2tsy (more details), 2.5 Å
PDB Description: crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes
SCOP Domain Sequences for d2tsya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tsya_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknla
spkqmlaelrsfvsamkaasra
SCOP Domain Coordinates for d2tsya_:
Click to download the PDB-style file with coordinates for d2tsya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tsya_:
- d2tsya_ appears in SCOP 1.57
- d2tsya_ appears in the current release, SCOPe 2.08
View in 3D
