Lineage for d1c8va_ (1c8v A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079595Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2079644Species Salmonella typhimurium [TaxId:90371] [51389] (46 PDB entries)
  8. 2079677Domain d1c8va_: 1c8v A: [28582]
    Other proteins in same PDB: d1c8vb_
    complexed with he1, na, plp

Details for d1c8va_

PDB Entry: 1c8v (more details), 2.2 Å

PDB Description: crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxyphenylthio)-butylphosphonic acid
PDB Compounds: (A:) tryptophan synthase; alpha chain

SCOPe Domain Sequences for d1c8va_:

Sequence, based on SEQRES records: (download)

>d1c8va_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii
eknlaspkqmlaelrsfvsamkaasr

Sequence, based on observed residues (ATOM records): (download)

>d1c8va_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtgaenrgplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiiek
nlaspkqmlaelrsfvsamkaasr

SCOPe Domain Coordinates for d1c8va_:

Click to download the PDB-style file with coordinates for d1c8va_.
(The format of our PDB-style files is described here.)

Timeline for d1c8va_: