Lineage for d1a5sa_ (1a5s A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116030Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 116096Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 116112Protein Trp synthase alpha-subunit [51388] (2 species)
  7. 116116Species Salmonella typhimurium [TaxId:90371] [51389] (21 PDB entries)
  8. 116129Domain d1a5sa_: 1a5s A: [28581]
    Other proteins in same PDB: d1a5sb_

Details for d1a5sa_

PDB Entry: 1a5s (more details), 2.3 Å

PDB Description: crystal structure of wild-type tryptophan synthase complexed with 5-fluoroindole propanol phosphate and l-ser bound as amino acrylate to the beta site

SCOP Domain Sequences for d1a5sa_:

Sequence, based on SEQRES records: (download)

>d1a5sa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii
eknlaspkqmlaelrsfvsamkaasr

Sequence, based on observed residues (ATOM records): (download)

>d1a5sa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtgaenlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspk
qmlaelrsfvsamkaasr

SCOP Domain Coordinates for d1a5sa_:

Click to download the PDB-style file with coordinates for d1a5sa_.
(The format of our PDB-style files is described here.)

Timeline for d1a5sa_: