Lineage for d1a5aa_ (1a5a A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079595Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2079644Species Salmonella typhimurium [TaxId:90371] [51389] (46 PDB entries)
  8. 2079667Domain d1a5aa_: 1a5a A: [28576]
    Other proteins in same PDB: d1a5ab_
    complexed with k, plp; mutant

Details for d1a5aa_

PDB Entry: 1a5a (more details), 1.9 Å

PDB Description: cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alphad60n) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alpha glu 49
PDB Compounds: (A:) tryptophan synthase (alpha chain)

SCOPe Domain Sequences for d1a5aa_:

Sequence, based on SEQRES records: (download)

>d1a5aa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplan
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

Sequence, based on observed residues (ATOM records): (download)

>d1a5aa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplan
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytylalpl
hhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmla
elrsfvsamkaasra

SCOPe Domain Coordinates for d1a5aa_:

Click to download the PDB-style file with coordinates for d1a5aa_.
(The format of our PDB-style files is described here.)

Timeline for d1a5aa_: