Lineage for d1jul__ (1jul -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18463Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 18504Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 18505Protein Indole-3-glycerophosphate synthase, IPGS [51385] (2 species)
  7. 18508Species Sulfolobus solfataricus [TaxId:2287] [51387] (4 PDB entries)
  8. 18511Domain d1jul__: 1jul - [28566]

Details for d1jul__

PDB Entry: 1jul (more details), 2 Å

PDB Description: indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a second orthorhombic crystal form

SCOP Domain Sequences for d1jul__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jul__ c.1.2.4 (-) Indole-3-glycerophosphate synthase, IPGS {Sulfolobus solfataricus}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
kikefil

SCOP Domain Coordinates for d1jul__:

Click to download the PDB-style file with coordinates for d1jul__.
(The format of our PDB-style files is described here.)

Timeline for d1jul__: