SCOPe 2.08: Domain d1jula_: 1jul A:

Lineage for d1jula_ (1jul A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [51387] (6 PDB entries)

8. Domain d1jula_: 1jul A: [28566]
   complexed with mes

Details for d1jula_

PDB Entry: 1jul, 2 Å

PDB Description: indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a second orthorhombic crystal form

PDB Compounds: (A:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d1jula_:

Sequence; same for both SEQRES and ATOM records:

>d1jula_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
kikefil

Timeline for d1jula_:

• d1jula_ first appeared (with stable ids) in SCOP 1.55, called d1jul__
  
• d1jula_ appears in SCOPe 2.07