![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
![]() | Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [51387] (6 PDB entries) |
![]() | Domain d1igsa_: 1igs A: [28565] complexed with po4 |
PDB Entry: 1igs (more details), 2 Å
SCOPe Domain Sequences for d1igsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igsa_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Sulfolobus solfataricus [TaxId: 2287]} prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe kikefil
Timeline for d1igsa_: