Lineage for d1pii_1 (1pii 1-254)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18463Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 18504Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 18505Protein Indole-3-glycerophosphate synthase, IPGS [51385] (2 species)
  7. 18506Species Escherichia coli [TaxId:562] [51386] (1 PDB entry)
  8. 18507Domain d1pii_1: 1pii 1-254 [28563]
    Other proteins in same PDB: d1pii_2

Details for d1pii_1

PDB Entry: 1pii (more details), 2 Å

PDB Description: three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution

SCOP Domain Sequences for d1pii_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pii_1 c.1.2.4 (1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli}
mqtvlakivadkaiwvearkqqqplasfqnevqpstrhfydalqgartafileckkasps
kgvirddfdpariaaiykhyasaisvltdekyfqgsfnflpivsqiapqpilckdfiidp
yqiylaryyqadacllmlsvldddqyrqlaavahslemgvltevsneeeqeraialgakv
vginnrdlrdlsidlnrtrelapklghnvtvisesgintyaqvrelshfangfligsalm
ahddlhaavrrvll

SCOP Domain Coordinates for d1pii_1:

Click to download the PDB-style file with coordinates for d1pii_1.
(The format of our PDB-style files is described here.)

Timeline for d1pii_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pii_2