SCOPe 2.07: Domain d1dl3b_: 1dl3 B:

Lineage for d1dl3b_ (1dl3 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [51384] (3 PDB entries)

8. Domain d1dl3b_: 1dl3 B: [28562]
   complexed with so4

Details for d1dl3b_

PDB Entry: 1dl3, 2.7 Å

PDB Description: crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima

PDB Compounds: (B:) protein (phosphoribosylantranilate isomerase)

SCOPe Domain Sequences for d1dl3b_:

Sequence, based on SEQRES records:

>d1dl3b_ c.1.2.4 (B:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]}
mvrvkicgitnledalfsvesgadyvgfvfypkskryispedarrisvelpvervgvfvn
eepekildvasyvqlnavqlhgeepielcrkiaerilvwkavgvsnerdmeralnyrefp
illdtktpeyggsgktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvssg
veafpgkkdhdsikmfiknakgl

Sequence, based on observed residues (ATOM records):

>d1dl3b_ c.1.2.4 (B:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]}
mvrvkicgitnledalfsvesgadyvgfvfypkskryispedarrisvelpvervgvfvn
eepekildvasyvqlnavqlhgeepielcrkiaerilvwkavgvsnerdmeralnyrefp
illdtktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvssgveafpgkkd
hdsikmfiknakgl

Timeline for d1dl3b_:

• d1dl3b_ first appeared (with stable ids) in SCOP 1.55
  
• d1dl3b_ appears in SCOPe 2.06
  
• d1dl3b_ appears in the current release, SCOPe 2.08