Lineage for d1dl3a_ (1dl3 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435860Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2435879Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species)
  7. 2435882Species Thermotoga maritima [TaxId:2336] [51384] (3 PDB entries)
  8. 2435884Domain d1dl3a_: 1dl3 A: [28561]
    complexed with so4

Details for d1dl3a_

PDB Entry: 1dl3 (more details), 2.7 Å

PDB Description: crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima
PDB Compounds: (A:) protein (phosphoribosylantranilate isomerase)

SCOPe Domain Sequences for d1dl3a_:

Sequence, based on SEQRES records: (download)

>d1dl3a_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]}
mvrvkicgitnledalfsvesgadyvgfvfypkskryispedarrisvelpvervgvfvn
eepekildvasyvqlnavqlhgeepielcrkiaerilvwkavgvsnerdmeralnyrefp
illdtktpeyggsgktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvssg
veafpgkkdhdsikmfiknakgl

Sequence, based on observed residues (ATOM records): (download)

>d1dl3a_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]}
mvrvkicgitnledalfsvesgadyvgfvfypkskryispedarrisvelpvervgvfvn
eepekildvasyvqlnavqlhgeepielcrkiaerilvwkavgvsnerdmeralnyrefp
illdtdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvssgveafpgkkdhds
ikmfiknakgl

SCOPe Domain Coordinates for d1dl3a_:

Click to download the PDB-style file with coordinates for d1dl3a_.
(The format of our PDB-style files is described here.)

Timeline for d1dl3a_: