Lineage for d1nsja_ (1nsj A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1816266Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 1816285Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species)
  7. 1816288Species Thermotoga maritima [TaxId:2336] [51384] (3 PDB entries)
  8. 1816289Domain d1nsja_: 1nsj A: [28560]
    complexed with po4

Details for d1nsja_

PDB Entry: 1nsj (more details), 2 Å

PDB Description: crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima
PDB Compounds: (A:) phosphoribosyl anthranilate isomerase

SCOPe Domain Sequences for d1nsja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]}
mvrvkicgitnledalfsvesgadavgfvfypkskryispedarrisvelppfvfrvgvf
vneepekildvasyvqlnavqlhgeepielcrkiaerilvikavgvsnerdmeralnyre
fpilldtktpeyggsgktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvs
sgveafpgkkdhdsikmfiknakgl

SCOPe Domain Coordinates for d1nsja_:

Click to download the PDB-style file with coordinates for d1nsja_.
(The format of our PDB-style files is described here.)

Timeline for d1nsja_: