Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species) |
Species Escherichia coli [TaxId:562] [51383] (1 PDB entry) merged in bifunctional enzyme with IPG synthase |
Domain d1piia1: 1pii A:255-452 [28559] Other proteins in same PDB: d1piia2 complexed with po4 |
PDB Entry: 1pii (more details), 2 Å
SCOPe Domain Sequences for d1piia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} genkvcgltrgqdakaaydagaiygglifvatsprcvnveqaqevmaaaplqyvgvfrnh diadvvdkakvlslaavqlhgneeqlyidtlrealpahvaiwkalsvgetlparefqhvd kyvldngqggsgqrfdwsllngqslgnvllagglgadncveaaqtgcagldfnsavesqp gikdarllasvfqtlray
Timeline for d1piia1: