Lineage for d1dqxd_ (1dqx D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116030Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 116054Family c.1.2.3: Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51375] (1 protein)
  6. 116055Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 116066Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51380] (2 PDB entries)
  8. 116074Domain d1dqxd_: 1dqx D: [28558]

Details for d1dqxd_

PDB Entry: 1dqx (more details), 2.4 Å

PDB Description: crystal structure of orotidine 5'-phosphate decarboxylase complexed to 6-hydroxyuridine 5'-phosphate (bmp)

SCOP Domain Sequences for d1dqxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqxd_ c.1.2.3 (D:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae)}
mhkatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
hvdiltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditn
ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslstgeytkgtvdiaksdkdfvi
gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
grdakvegeryrkagweaylrrcgqqd

SCOP Domain Coordinates for d1dqxd_:

Click to download the PDB-style file with coordinates for d1dqxd_.
(The format of our PDB-style files is described here.)

Timeline for d1dqxd_: