Lineage for d1dqxc_ (1dqx C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64418Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 64433Family c.1.2.3: Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51375] (1 protein)
  6. 64434Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 64445Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51380] (2 PDB entries)
  8. 64452Domain d1dqxc_: 1dqx C: [28557]

Details for d1dqxc_

PDB Entry: 1dqx (more details), 2.4 Å

PDB Description: crystal structure of orotidine 5'-phosphate decarboxylase complexed to 6-hydroxyuridine 5'-phosphate (bmp)

SCOP Domain Sequences for d1dqxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqxc_ c.1.2.3 (C:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae)}
mhkatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
hvdiltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditn
ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslstgeytkgtvdiaksdkdfvi
gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
grdakvegeryrkagweaylrrcgqqd

SCOP Domain Coordinates for d1dqxc_:

Click to download the PDB-style file with coordinates for d1dqxc_.
(The format of our PDB-style files is described here.)

Timeline for d1dqxc_: