SCOPe 2.01: Domain d1dqwd_: 1dqw D:

Lineage for d1dqwd_ (1dqw D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51380] (2 PDB entries)

8. Domain d1dqwd_: 1dqw D: [28554]

Details for d1dqwd_

PDB Entry: 1dqw, 2.1 Å

PDB Description: crystal structure of orotidine 5'-phosphate decarboxylase

PDB Compounds: (D:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1dqwd_:

Sequence; same for both SEQRES and ATOM records:

>d1dqwd_ c.1.2.3 (D:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhkatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
hvdiltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditn
ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslstgeytkgtvdiaksdkdfvi
gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
grdakvegeryrkagweaylrrcgqqd

Timeline for d1dqwd_:

• d1dqwd_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqwd_ appears in SCOP 1.75
  
• d1dqwd_ appears in SCOPe 2.02
  
• d1dqwd_ appears in the current release, SCOPe 2.08