Lineage for d1dqwd_ (1dqw D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826771Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2826811Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 2826816Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51380] (2 PDB entries)
  8. 2826820Domain d1dqwd_: 1dqw D: [28554]

Details for d1dqwd_

PDB Entry: 1dqw (more details), 2.1 Å

PDB Description: crystal structure of orotidine 5'-phosphate decarboxylase
PDB Compounds: (D:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1dqwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqwd_ c.1.2.3 (D:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhkatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
hvdiltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditn
ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslstgeytkgtvdiaksdkdfvi
gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
grdakvegeryrkagweaylrrcgqqd

SCOPe Domain Coordinates for d1dqwd_:

Click to download the PDB-style file with coordinates for d1dqwd_.
(The format of our PDB-style files is described here.)

Timeline for d1dqwd_: