Lineage for d1dv7a_ (1dv7 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18463Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 18478Family c.1.2.3: Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51375] (1 protein)
  6. 18479Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 18498Species Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (2 PDB entries)
  8. 18503Domain d1dv7a_: 1dv7 A: [28550]

Details for d1dv7a_

PDB Entry: 1dv7 (more details), 1.8 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase

SCOP Domain Sequences for d1dv7a_:

Sequence, based on SEQRES records: (download)

>d1dv7a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum}
rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
vgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesi

Sequence, based on observed residues (ATOM records): (download)

>d1dv7a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum}
rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
etlrfadaiivgrsiyladnpaaaaagiiesi

SCOP Domain Coordinates for d1dv7a_:

Click to download the PDB-style file with coordinates for d1dv7a_.
(The format of our PDB-style files is described here.)

Timeline for d1dv7a_: