Lineage for d1dvjd_ (1dvj D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079188Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 2079225Species Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 2079234Domain d1dvjd_: 1dvj D: [28549]
    Other proteins in same PDB: d1dvja2, d1dvjc2
    complex with 6-azaUMP
    complexed with up6

Details for d1dvjd_

PDB Entry: 1dvj (more details), 1.5 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase complexed with 6-azaump
PDB Compounds: (D:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1dvjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvjd_ c.1.2.3 (D:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
pgetlrfadaiivgrsiyladnpaaaaagiiesi

SCOPe Domain Coordinates for d1dvjd_:

Click to download the PDB-style file with coordinates for d1dvjd_.
(The format of our PDB-style files is described here.)

Timeline for d1dvjd_: