Lineage for d1dvjc_ (1dvj C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681364Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 681395Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 681396Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (18 PDB entries)
  8. 681402Domain d1dvjc_: 1dvj C: [28548]

Details for d1dvjc_

PDB Entry: 1dvj (more details), 1.5 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase complexed with 6-azaump
PDB Compounds: (C:) orotidine 5'-phosphate decarboxylase

SCOP Domain Sequences for d1dvjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvjc_ c.1.2.3 (C:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
pgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkeaelaa

SCOP Domain Coordinates for d1dvjc_:

Click to download the PDB-style file with coordinates for d1dvjc_.
(The format of our PDB-style files is described here.)

Timeline for d1dvjc_: