Lineage for d1dvjb_ (1dvj B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2090369Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2090409Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 2090446Species Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 2090453Domain d1dvjb_: 1dvj B: [28547]
    Other proteins in same PDB: d1dvja2, d1dvjc2
    complex with 6-azaUMP
    complexed with up6

Details for d1dvjb_

PDB Entry: 1dvj (more details), 1.5 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase complexed with 6-azaump
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1dvjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvjb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadfkv
adipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaem
fiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetl
rfadaiivgrsiyladnpaaaaagiiesikd

SCOPe Domain Coordinates for d1dvjb_:

Click to download the PDB-style file with coordinates for d1dvjb_.
(The format of our PDB-style files is described here.)

Timeline for d1dvjb_: