Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) |
Family c.1.2.3: Decarboxylase [51375] (2 proteins) |
Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species) |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries) |
Domain d1dvjb_: 1dvj B: [28547] |
PDB Entry: 1dvj (more details), 1.5 Å
SCOP Domain Sequences for d1dvjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvjb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum} rlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadfkv adipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaem fiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetl rfadaiivgrsiyladnpaaaaagiiesikd
Timeline for d1dvjb_: