Lineage for d2bgga3 (2bgg A:171-427)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124854Family c.55.3.15: PIWI domain C-terminal [310608] (4 protein domains)
    PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1)
  6. 2124874Protein Hypothetical protein AF1318 [310687] (1 species)
  7. 2124875Species Archaeoglobus fulgidus [TaxId:2234] [310904] (3 PDB entries)
  8. 2124877Domain d2bgga3: 2bgg A:171-427 [285428]
    Other proteins in same PDB: d2bgga2, d2bggb2
    protein/RNA complex; complexed with mn

Details for d2bgga3

PDB Entry: 2bgg (more details), 2.2 Å

PDB Description: the structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt sirna duplex.
PDB Compounds: (A:) protein af1318

SCOPe Domain Sequences for d2bgga3:

Sequence, based on SEQRES records: (download)

>d2bgga3 c.55.3.15 (A:171-427) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
lnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylksti
kkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyail
hlnethpfwvmgdpnnrfhpyegtkvklsskrylltllqpylkrnglemvtpikplsvei
vsdnwtseeyyhnvheildeiyylskmnwrgfrsrnlpvtvnypklvagiianvnryggy
pinpegnrslqtnpwfl

Sequence, based on observed residues (ATOM records): (download)

>d2bgga3 c.55.3.15 (A:171-427) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
lnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylksti
kkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyail
hlnethpfwvmegtkvklsskrylltllqpyvtpikplsveivsdnwtseeyyhnvheil
deiyylskmnwrgfrsrnlpvtvnypklvagiianvnryggypinrslqtnpwfl

SCOPe Domain Coordinates for d2bgga3:

Click to download the PDB-style file with coordinates for d2bgga3.
(The format of our PDB-style files is described here.)

Timeline for d2bgga3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bgga2