![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) ![]() |
![]() | Family c.1.2.3: Decarboxylase [51375] (2 proteins) |
![]() | Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [51378] (3 PDB entries) |
![]() | Domain d1eixa_: 1eix A: [28542] |
PDB Entry: 1eix (more details), 2.5 Å
SCOP Domain Sequences for d1eixa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli} vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
Timeline for d1eixa_: