Lineage for d1dbtc_ (1dbt C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435437Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2435477Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 2435478Species Bacillus subtilis [TaxId:1423] [51377] (1 PDB entry)
  8. 2435481Domain d1dbtc_: 1dbt C: [28541]
    complex with UMP
    complexed with u5p

Details for d1dbtc_

PDB Entry: 1dbt (more details), 2.4 Å

PDB Description: crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump
PDB Compounds: (C:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1dbtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbtc_ c.1.2.3 (C:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]}
nnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfldlk
lhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavtql
tstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltvtp
girmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrleweg

SCOPe Domain Coordinates for d1dbtc_:

Click to download the PDB-style file with coordinates for d1dbtc_.
(The format of our PDB-style files is described here.)

Timeline for d1dbtc_: