SCOP 1.75: Domain d1dbtc_: 1dbt C:

Lineage for d1dbtc_ (1dbt C:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.3: Decarboxylase [51375] (3 proteins)

6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)

7. Species Bacillus subtilis [TaxId:1423] [51377] (1 PDB entry)

8. Domain d1dbtc_: 1dbt C: [28541]
   complex with UMP
   complexed with u5p

Details for d1dbtc_

PDB Entry: 1dbt, 2.4 Å

PDB Description: crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump

PDB Compounds: (C:) orotidine 5'-phosphate decarboxylase

SCOP Domain Sequences for d1dbtc_:

Sequence; same for both SEQRES and ATOM records:

>d1dbtc_ c.1.2.3 (C:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]}
nnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfldlk
lhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavtql
tstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltvtp
girmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrleweg

Timeline for d1dbtc_:

• d1dbtc_ first appeared (with stable ids) in SCOP 1.55
  
• d1dbtc_ appears in SCOP 1.73
  
• d1dbtc_ appears in SCOPe 2.01
  
• d1dbtc_ appears in the current release, SCOPe 2.08