Lineage for d1dbtc_ (1dbt C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64418Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 64433Family c.1.2.3: Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51375] (1 protein)
  6. 64434Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 64441Species Bacillus subtilis [TaxId:1423] [51377] (1 PDB entry)
  8. 64444Domain d1dbtc_: 1dbt C: [28541]

Details for d1dbtc_

PDB Entry: 1dbt (more details), 2.4 Å

PDB Description: crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump

SCOP Domain Sequences for d1dbtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbtc_ c.1.2.3 (C:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis}
nnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfldlk
lhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavtql
tstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltvtp
girmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrleweg

SCOP Domain Coordinates for d1dbtc_:

Click to download the PDB-style file with coordinates for d1dbtc_.
(The format of our PDB-style files is described here.)

Timeline for d1dbtc_: