SCOP 1.71: Domain d1dbtb_: 1dbt B:

Lineage for d1dbtb_ (1dbt B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families)

5. Family c.1.2.3: Decarboxylase [51375] (2 proteins)

6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [51377] (1 PDB entry)

8. Domain d1dbtb_: 1dbt B: [28540]

Details for d1dbtb_

PDB Entry: 1dbt, 2.4 Å

PDB Description: crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump

SCOP Domain Sequences for d1dbtb_:

Sequence; same for both SEQRES and ATOM records:

>d1dbtb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis}
nnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfldlk
lhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavtql
tstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltvtp
girmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrleweg

Timeline for d1dbtb_:

• d1dbtb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dbtb_ appears in SCOP 1.69
  
• d1dbtb_ appears in SCOP 1.73
  
• d1dbtb_ appears in the current release, SCOPe 2.08