Lineage for d1dbtb_ (1dbt B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826771Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2826811Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 2826812Species Bacillus subtilis [TaxId:1423] [51377] (1 PDB entry)
  8. 2826814Domain d1dbtb_: 1dbt B: [28540]
    complex with UMP
    complexed with u5p

Details for d1dbtb_

PDB Entry: 1dbt (more details), 2.4 Å

PDB Description: crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1dbtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbtb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]}
nnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfldlk
lhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavtql
tstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltvtp
girmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrleweg

SCOPe Domain Coordinates for d1dbtb_:

Click to download the PDB-style file with coordinates for d1dbtb_.
(The format of our PDB-style files is described here.)

Timeline for d1dbtb_: