Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species) |
Species Bacillus subtilis [TaxId:1423] [51377] (1 PDB entry) |
Domain d1dbtb_: 1dbt B: [28540] complex with UMP complexed with u5p |
PDB Entry: 1dbt (more details), 2.4 Å
SCOPe Domain Sequences for d1dbtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dbtb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} nnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfldlk lhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavtql tstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltvtp girmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrleweg
Timeline for d1dbtb_: