Lineage for d1dbta_ (1dbt A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116030Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 116054Family c.1.2.3: Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51375] (1 protein)
  6. 116055Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 116062Species Bacillus subtilis [TaxId:1423] [51377] (1 PDB entry)
  8. 116063Domain d1dbta_: 1dbt A: [28539]

Details for d1dbta_

PDB Entry: 1dbt (more details), 2.4 Å

PDB Description: crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump

SCOP Domain Sequences for d1dbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis}
mknnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfld
lklhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavt
qltstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltv
tpgirmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrlewegi

SCOP Domain Coordinates for d1dbta_:

Click to download the PDB-style file with coordinates for d1dbta_.
(The format of our PDB-style files is described here.)

Timeline for d1dbta_: