Lineage for d1rpxc_ (1rpx C:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) 
Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein) Protein D-ribulose-5-phosphate 3-epimerase [51373] (1 species) Species Potato (Solanum tuberosum) [TaxId:4113] [51374] (1 PDB entry) 
Domain d1rpxc_: 1rpx C: [28538]
Details for d1rpxc_
PDB Entry: 1rpx (more details), 2.3 Å
PDB Description: d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts
SCOP Domain Sequences for d1rpxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rpxc_ c.1.2.2 (C:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum)}
srvdkfsksdiivspsilsanfsklgeqvkaieqagcdwihvdvmdgrfvpnitigplvv
dslrpitdlpldvhlmivepdqrvpdfikagadivsvhceqsstihlhrtinqikslgak
agvvlnpgtpltaieyvldavdlvlimsvnpgfggqsfiesqvkkisdlrkicaerglnp
wievdggvgpknaykvieaganalvagsavfgapdyaeaikgiktskrpe
SCOP Domain Coordinates for d1rpxc_:
Click to download the PDB-style file with coordinates for d1rpxc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rpxc_:
- d1rpxc_ first appeared (with stable ids) in SCOP 1.55
- d1rpxc_ appears in SCOP 1.59
- d1rpxc_ appears in SCOP 1.63
- d1rpxc_ appears in the current release, SCOPe 2.08
View in 3D
