Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein) automatically mapped to Pfam PF00834 |
Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species) |
Species Potato (Solanum tuberosum) [TaxId:4113] [51374] (1 PDB entry) |
Domain d1rpxb_: 1rpx B: [28537] complexed with so4 |
PDB Entry: 1rpx (more details), 2.3 Å
SCOPe Domain Sequences for d1rpxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rpxb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} srvdkfsksdiivspsilsanfsklgeqvkaieqagcdwihvdvmdgrfvpnitigplvv dslrpitdlpldvhlmivepdqrvpdfikagadivsvhceqsstihlhrtinqikslgak agvvlnpgtpltaieyvldavdlvlimsvnpgfggqsfiesqvkkisdlrkicaerglnp wievdggvgpknaykvieaganalvagsavfgapdyaeaikgiktskrpe
Timeline for d1rpxb_: