Lineage for d1rpxb_ (1rpx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826748Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (2 proteins)
    automatically mapped to Pfam PF00834
  6. 2826749Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)
  7. 2826753Species Potato (Solanum tuberosum) [TaxId:4113] [51374] (1 PDB entry)
  8. 2826755Domain d1rpxb_: 1rpx B: [28537]
    complexed with so4

Details for d1rpxb_

PDB Entry: 1rpx (more details), 2.3 Å

PDB Description: d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts
PDB Compounds: (B:) protein (ribulose-phosphate 3-epimerase)

SCOPe Domain Sequences for d1rpxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpxb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]}
srvdkfsksdiivspsilsanfsklgeqvkaieqagcdwihvdvmdgrfvpnitigplvv
dslrpitdlpldvhlmivepdqrvpdfikagadivsvhceqsstihlhrtinqikslgak
agvvlnpgtpltaieyvldavdlvlimsvnpgfggqsfiesqvkkisdlrkicaerglnp
wievdggvgpknaykvieaganalvagsavfgapdyaeaikgiktskrpe

SCOPe Domain Coordinates for d1rpxb_:

Click to download the PDB-style file with coordinates for d1rpxb_.
(The format of our PDB-style files is described here.)

Timeline for d1rpxb_: