Lineage for d1rpxa_ (1rpx A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18463Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 18472Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)
  6. 18473Protein D-ribulose-5-phosphate 3-epimerase [51373] (1 species)
  7. 18474Species Potato (Solanum tuberosum) [TaxId:4113] [51374] (1 PDB entry)
  8. 18475Domain d1rpxa_: 1rpx A: [28536]

Details for d1rpxa_

PDB Entry: 1rpx (more details), 2.3 Å

PDB Description: d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts

SCOP Domain Sequences for d1rpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum)}
srvdkfsksdiivspsilsanfsklgeqvkaieqagcdwihvdvmdgrfvpnitigplvv
dslrpitdlpldvhlmivepdqrvpdfikagadivsvhceqsstihlhrtinqikslgak
agvvlnpgtpltaieyvldavdlvlimsvnpgfggqsfiesqvkkisdlrkicaerglnp
wievdggvgpknaykvieaganalvagsavfgapdyaeaikgiktskrpe

SCOP Domain Coordinates for d1rpxa_:

Click to download the PDB-style file with coordinates for d1rpxa_.
(The format of our PDB-style files is described here.)

Timeline for d1rpxa_: