Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) |
Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins) structural evidence for the gene duplication within the barrel fold |
Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species) |
Species Thermotoga maritima [TaxId:2336] [51371] (4 PDB entries) |
Domain d1thfd_: 1thf D: [28535] complexed with po4 |
PDB Entry: 1thf (more details), 1.45 Å
SCOP Domain Sequences for d1thfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} mlakriiacldvkdgrvvkgsnfenlrdsgdpvelgkfyseigidelvflditasvekrk tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey lkkhgvnvrlegl
Timeline for d1thfd_: