SCOPe 2.01: Domain d1qo2b_: 1qo2 B:

Lineage for d1qo2b_ (1qo2 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold

6. Protein Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA [51368] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [51369] (2 PDB entries)

8. Domain d1qo2b_: 1qo2 B: [28534]

Details for d1qo2b_

PDB Entry: 1qo2, 1.85 Å

PDB Description: crystal structure of n-((5'-phosphoribosyl)-formimino)-5- aminoimidazol-4-carboxamid ribonucleotid isomerase (ec 3.1.3.15, hisa)

SCOPe Domain Sequences for d1qo2b_:

Sequence; same for both SEQRES and ATOM records:

>d1qo2b_ c.1.2.1 (B:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]}
mlvvpaidlfrgkvarmikgrkentifyekdpvelveklieegftlihvvdlsnaiensg
enlpvleklsefaehiqigggirsldyaeklrklgyrrqivsskvledpsflkslreidv
epvfsldtrggrvafkgwlaeeeidpvsllkrlkeygleeivhteiekdgtlqehdfslt
kkiaieaevkvlaaggissenslktaqkvhtetngllkgvivgraflegiltvevmkrya
r

Timeline for d1qo2b_:

• d1qo2b_ first appeared (with stable ids) in SCOP 1.55
  
• d1qo2b_ appears in SCOP 1.75
  
• d1qo2b_ appears in SCOPe 2.02
  
• d1qo2b_ appears in the current release, SCOPe 2.08