Lineage for d1b9ba_ (1b9b A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Thermotoga maritima [TaxId:243274] [51365] (1 PDB entry) 
Domain d1b9ba_: 1b9b A: [28531]
Details for d1b9ba_
PDB Entry: 1b9b (more details), 2.85 Å
PDB Description: triosephosphate isomerase of thermotoga maritima
SCOP Domain Sequences for d1b9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima}
trklilagnwkmhktiseakkfvsllvnelhdvkefeivvcppftalsevgeilsgrnik
lgaqnvfyedqgaftgeisplmlqeigveyvivghserrrifkeddefinrkvkavlekg
mtpilcvgetleerekgltfcvvekqvregfygldkeeakrvviayepvwaigtgrvatp
qqaqevhafirkllsemydeetagsirilyggsikpdnflglivqkdidgglvggaslke
sfielarimrgv
SCOP Domain Coordinates for d1b9ba_:
Click to download the PDB-style file with coordinates for d1b9ba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b9ba_:
- d1b9ba_ first appeared (with stable ids) in SCOP 1.55
- d1b9ba_ appears in SCOP 1.57
- d1b9ba_ appears in SCOP 1.61
- d1b9ba_ appears in the current release, SCOPe 2.08
View in 3D
