Lineage for d1aw2h_ (1aw2 H:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18354Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 18355Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 18356Protein Triosephosphate isomerase [51353] (12 species)
  7. 18446Species Vibrio marinus [TaxId:90736] [51364] (2 PDB entries)
  8. 18460Domain d1aw2h_: 1aw2 H: [28528]

Details for d1aw2h_

PDB Entry: 1aw2 (more details), 2.65 Å

PDB Description: triosephosphate isomerase of vibrio marinus

SCOP Domain Sequences for d1aw2h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw2h_ c.1.1.1 (H:) Triosephosphate isomerase {Vibrio marinus}
rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
ksfaaiakaaaeak

SCOP Domain Coordinates for d1aw2h_:

Click to download the PDB-style file with coordinates for d1aw2h_.
(The format of our PDB-style files is described here.)

Timeline for d1aw2h_: