Lineage for d1aw2g_ (1aw2 G:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 115905Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 115906Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 115907Protein Triosephosphate isomerase [51353] (13 species)
  7. 116013Species Vibrio marinus [TaxId:90736] [51364] (2 PDB entries)
  8. 116026Domain d1aw2g_: 1aw2 G: [28527]

Details for d1aw2g_

PDB Entry: 1aw2 (more details), 2.65 Å

PDB Description: triosephosphate isomerase of vibrio marinus

SCOP Domain Sequences for d1aw2g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw2g_ c.1.1.1 (G:) Triosephosphate isomerase {Vibrio marinus}
rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
ksfaaiakaaaeaka

SCOP Domain Coordinates for d1aw2g_:

Click to download the PDB-style file with coordinates for d1aw2g_.
(The format of our PDB-style files is described here.)

Timeline for d1aw2g_: