Lineage for d1aw2d_ (1aw2 D:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (12 species) 
Species Vibrio marinus [TaxId:90736] [51364] (2 PDB entries) 
Domain d1aw2d_: 1aw2 D: [28525]
Details for d1aw2d_
PDB Entry: 1aw2 (more details), 2.65 Å
PDB Description: triosephosphate isomerase of vibrio marinus
SCOP Domain Sequences for d1aw2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aw2d_ c.1.1.1 (D:) Triosephosphate isomerase {Vibrio marinus}
rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
ksfaaiakaaaeaka
SCOP Domain Coordinates for d1aw2d_:
Click to download the PDB-style file with coordinates for d1aw2d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aw2d_:
- d1aw2d_ appears in SCOP 1.57
- d1aw2d_ appears in the current release, SCOPe 2.08
View in 3D
