Lineage for d1aw1k_ (1aw1 K:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814175Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 814176Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 814177Protein Triosephosphate isomerase [51353] (18 species)
  7. 814366Species Vibrio marinus [TaxId:90736] [51364] (2 PDB entries)
  8. 814374Domain d1aw1k_: 1aw1 K: [28522]
    complexed with pga

Details for d1aw1k_

PDB Entry: 1aw1 (more details), 2.7 Å

PDB Description: triosephosphate isomerase of vibrio marinus complexed with 2-phosphoglycolate
PDB Compounds: (K:) triosephosphate isomerase

SCOP Domain Sequences for d1aw1k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw1k_ c.1.1.1 (K:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]}
rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
ksfaaiakaaaeak

SCOP Domain Coordinates for d1aw1k_:

Click to download the PDB-style file with coordinates for d1aw1k_.
(The format of our PDB-style files is described here.)

Timeline for d1aw1k_: