Lineage for d1aw1j_ (1aw1 J:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 968087Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 968088Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 968089Protein Triosephosphate isomerase [51353] (20 species)
  7. 968370Species Vibrio marinus [TaxId:90736] [51364] (2 PDB entries)
  8. 968377Domain d1aw1j_: 1aw1 J: [28521]
    complexed with pga

Details for d1aw1j_

PDB Entry: 1aw1 (more details), 2.7 Å

PDB Description: triosephosphate isomerase of vibrio marinus complexed with 2-phosphoglycolate
PDB Compounds: (J:) triosephosphate isomerase

SCOPe Domain Sequences for d1aw1j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw1j_ c.1.1.1 (J:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]}
rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
ksfaaiakaaaeaka

SCOPe Domain Coordinates for d1aw1j_:

Click to download the PDB-style file with coordinates for d1aw1j_.
(The format of our PDB-style files is described here.)

Timeline for d1aw1j_: