Lineage for d1aw1e_ (1aw1 E:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Vibrio marinus [TaxId:90736] [51364] (2 PDB entries) 
Domain d1aw1e_: 1aw1 E: [28518]
Details for d1aw1e_
PDB Entry: 1aw1 (more details), 2.7 Å
PDB Description: triosephosphate isomerase of vibrio marinus complexed with 2-phosphoglycolate
SCOP Domain Sequences for d1aw1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aw1e_ c.1.1.1 (E:) Triosephosphate isomerase {Vibrio marinus}
rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
ksfaaiakaaaeak
SCOP Domain Coordinates for d1aw1e_:
Click to download the PDB-style file with coordinates for d1aw1e_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aw1e_:
- d1aw1e_ first appeared (with stable ids) in SCOP 1.55
- d1aw1e_ appears in SCOP 1.59
- d1aw1e_ appears in SCOP 1.63
- d1aw1e_ appears in the current release, SCOPe 2.08
View in 3D
