Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) automatically mapped to Pfam PF00121 |
Protein Triosephosphate isomerase [51353] (21 species) |
Species Vibrio marinus [TaxId:90736] [51364] (2 PDB entries) |
Domain d1aw1a_: 1aw1 A: [28515] complexed with pga |
PDB Entry: 1aw1 (more details), 2.7 Å
SCOPe Domain Sequences for d1aw1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]} rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda ksfaaiakaaaeaka
Timeline for d1aw1a_: